PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100212970251
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 454aa    MW: 49833.3 Da    PI: 5.2911
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100212970251genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1085e-34276330155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+r+rWtpeLHe Fveav++LGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Ote100212970251|100212970251 276 KQRMRWTPELHETFVEAVNKLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 330
                                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.521273333IPR017930Myb domain
SuperFamilySSF466894.12E-18274330IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-31275332IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-25276330IPR006447Myb domain, plants
PfamPF002491.8E-10278329IPR001005SANT/Myb domain
PfamPF143792.9E-24361405IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MEAKHAMPIQ SSGSRQICSI GASTSISASF PVPPTALEEM YPRFSESQQV PLERELTQLP  60
PTAVSSLSSN SGAVGHIFSS SSGFSTDLHF SSTQQHQEKH PKQSPFISQS SSSGKSVNLP  120
HSVDSQVLQS TASSHFNKEN NGTWCTDTLP DYLDFPMSTP TQSSQLYGSN STGITIPQED  180
LGKSNDWQDW ADQLITDNDA LTADWSGLLA DTSVGDPQQN LEVIFLSSSF YHALLIPHQC  240
TSISNQQLHK PQQQPITPGE ICINGTQSSS NAAPAKQRMR WTPELHETFV EAVNKLGGSE  300
RATPKGVLKL MKVEGLTIYH VKSHLQKYRT ARYKPETAEG SLEQKSASIE DLSSLDLKTG  360
IEITEALRLQ MEVQKRLHEQ LEIQRNLQLR IEEQGRYLQM MFEKSGMEMA KGATSTNSPT  420
EDDSAVEGEK TNAEGPGENS QPPFPPAKRA KLTD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080098.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
TrEMBLA0A022S2540.0A0A022S254_ERYGU; Uncharacterized protein
STRINGVIT_07s0005g04120.t011e-154(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349